Iright
BRAND / VENDOR: Proteintech

Proteintech, 16564-1-AP, TMEM11 Polyclonal antibody

CATALOG NUMBER: 16564-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM11 (16564-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM11 in WB, ELISA applications with reactivity to human, mouse, rat samples 16564-1-AP targets TMEM11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TMEM11, also named as C17orf35 and PM1, belongs to the TMEM11 family. TMEM11 is a mitochondrial inner-membrane protein facing the matrix. It regulates mitochondrial morphogenesis independently of the DRP1/MFN fission/fusion pathways.(PMID:21274005) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9839 Product name: Recombinant human TMEM11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC020815 Sequence: MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIA Predict reactive species Full Name: transmembrane protein 11 Calculated Molecular Weight: 192 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC020815 Gene Symbol: TMEM11 Gene ID (NCBI): 8834 RRID: AB_2287468 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17152 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924