Iright
BRAND / VENDOR: Proteintech

Proteintech, 16569-1-AP, PPP2R2A Polyclonal antibody

CATALOG NUMBER: 16569-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PPP2R2A (16569-1-AP) by Proteintech is a Polyclonal antibody targeting PPP2R2A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16569-1-AP targets PPP2R2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, C6 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The serine/threonine protein phosphatase 2A (PP2A) is a master regulator of the complex cellular signaling that occurs during all stages of mammalian development. PPP2R2A, also known as B55A or PR55A, is a regulatory subunit of PP2A expressed in an Akt-dependent manner in epidermis during barrier formation. PPP2R2A participates in the negative control of cell growth and division. PPP2R2A has been proved to be a tumor suppressor that can inhibit the proliferation of a variety of cancer cells, such as prostate cancer cells(PMID: 21872824). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9851 Product name: Recombinant human PPP2R2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-447 aa of BC041071 Sequence: IRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN Predict reactive species Full Name: protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform Calculated Molecular Weight: 477 aa, 52 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC041071 Gene Symbol: PPP2R2A Gene ID (NCBI): 5520 RRID: AB_2878280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924