Iright
BRAND / VENDOR: Proteintech

Proteintech, 16571-1-AP, Fetuin-A/AHSG Polyclonal antibody

CATALOG NUMBER: 16571-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Fetuin-A/AHSG (16571-1-AP) by Proteintech is a Polyclonal antibody targeting Fetuin-A/AHSG in WB, IHC, ELISA applications with reactivity to human samples 16571-1-AP targets Fetuin-A/AHSG in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human liver tissue, human heart tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Fetuin-A, also named as Alpha2-HS glycoprotein (AHSG), is a member of cystatin superfamily of protease inhibitors. It is a highly expressed glycoprotein in various fetal tissues whereas it is mainly expressed by the liver in adults. Fetuin A, an extracellular inhibitor of transforming growth factor β, is a profibrogenic stimulus in liver disease. Circulating fetuin-A may be a beneficial serum biomarker in the detection of liver and vascular fibrosis progression in patients with non-alcoholic fatty liver disease. It is also involved in several functions, such as endocytosis, brain development and the formation of bone tissue. Fetuin-A exerts its effects on the cardiovascular system by two different mechanisms. On the one hand it inhibits ins signaling and induces ins resistance contributing to the onset of atherosclerosis and on the other hand it inhibits calcium deposition and protects from vascular calcification. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, plasmodium falciparum Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9853 Product name: Recombinant human AHSG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-367 aa of BC048198 Sequence: MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV Predict reactive species Full Name: alpha-2-HS-glycoprotein Calculated Molecular Weight: 367 aa, 39 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC048198 Gene Symbol: Fetuin-A Gene ID (NCBI): 197 RRID: AB_2224119 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02765 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924