Proteintech, 16598-1-AP, HEXIM2 Polyclonal antibody

Size: 20ul / 150ul The HEXIM2 (16598-1-AP) by Proteintech is a Polyclonal antibody targeting HEXIM2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16598-1-AP targets HEXIM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, COLO 320 cells, HEK-293 cells Positive IHC detected in: human lung cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9754 Product name: Recombinant human HEXIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-286 aa of BC025970 Sequence: MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT Predict reactive species Full Name: hexamthylene bis-acetamide inducible 2 Calculated Molecular Weight: 286 aa, 32 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC025970 Gene Symbol: HEXIM2 Gene ID (NCBI): 124790 RRID: AB_2878286 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MH2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.