Iright
BRAND / VENDOR: Proteintech

Proteintech, 16601-1-AP, PGCP Polyclonal antibody

CATALOG NUMBER: 16601-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PGCP (16601-1-AP) by Proteintech is a Polyclonal antibody targeting PGCP in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 16601-1-AP targets PGCP in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells, human placenta tissue, human plasma tissue, mouse kidney tissue Positive IP detected in: mouse kidney tissue Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information PGCP(plasma glutamate carboxypeptidase) is also named as LCH1,CPQ and belongs to the peptidase M28 family. It may play an important role in the hydrolysis of circulating peptides. It catalyzes more efficiently the hydrolysis of dipeptides with unsubstituted terminals into amino acids. It is a proteinase that acts on the unsubstituted N- and C-termini of dipeptides. It has been suggested that this PGCP is involved in the release of thyroxine(PMID:20951214). Human PGCP is a metallopeptidase with five potential glycosylation sites, whose activity depends on dimerizationand it can be detected a band of 65-72kd in FRTL-5 cells which is pro-PGCP(PMID:22127294). It can be N-glycosylated(PMID:10206990). It has the pro-form of 60-65 kDa and mature form of 55 kDa(PMID:20951214). Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9770 Product name: Recombinant human PGCP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-472 aa of BC020689 Sequence: LEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS Predict reactive species Full Name: plasma glutamate carboxypeptidase Calculated Molecular Weight: 472 aa, 52 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC020689 Gene Symbol: PGCP Gene ID (NCBI): 10404 RRID: AB_2160929 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924