Proteintech, 16606-1-AP, KCNMB2 Polyclonal antibody

Size: 20ul / 150ul The KCNMB2 (16606-1-AP) by Proteintech is a Polyclonal antibody targeting KCNMB2 in IHC, ELISA applications with reactivity to human samples 16606-1-AP targets KCNMB2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9793 Product name: Recombinant human KCNMB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-235 aa of BC017825 Sequence: MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR Predict reactive species Full Name: potassium large conductance calcium-activated channel, subfamily M, beta member 2 Calculated Molecular Weight: 235 aa, 27 kDa GenBank Accession Number: BC017825 Gene Symbol: KCNMB2 Gene ID (NCBI): 10242 RRID: AB_2878287 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y691 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.