Proteintech, 16618-1-AP, ZNF143 Polyclonal antibody

Size: 20ul / 150ul The ZNF143 (16618-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF143 in WB, ELISA applications with reactivity to human, mouse, rat samples 16618-1-AP targets ZNF143 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Zinc finger protein143(ZNF143) contains a separete acidic activation and 7 zinc finger domains. It's a transcription factor that required for activation of the majority of vertebrate snRNA and snRNA-type genes, which transcribed by RNA pol II and pol III. Also, it binds to the SPH motif of small nuclear RNA (snRNA) gene promoters and participates in efficient U6 RNA polymerase III transcription via its interaction with CHD8 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9914 Product name: Recombinant human ZNF143 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-626 aa of BC020219 Sequence: KPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLVMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQGETPGLDD Predict reactive species Full Name: zinc finger protein 143 Calculated Molecular Weight: 626 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC020219 Gene Symbol: ZNF143 Gene ID (NCBI): 7702 RRID: AB_2218324 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52747 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.