Iright
BRAND / VENDOR: Proteintech

Proteintech, 16628-1-AP, COPS7A Polyclonal antibody

CATALOG NUMBER: 16628-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The COPS7A (16628-1-AP) by Proteintech is a Polyclonal antibody targeting COPS7A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16628-1-AP targets COPS7A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, mouse brain tissue, PC-12 cells, HeLa cells, rat brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information COPS7A is component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. COPS7A was consistently expressed in oligodendrocyte lineage cells, and was down-regulated during the peak period of myelination. COPS7A associated physically with Olig1, and it might thus serve as a novel negative regulator in oligodendrocytes differentiation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9958 Product name: Recombinant human COPS7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC011789 Sequence: MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN Predict reactive species Full Name: COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis) Calculated Molecular Weight: 275 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC011789 Gene Symbol: COPS7A Gene ID (NCBI): 50813 RRID: AB_2081787 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924