Proteintech, 16630-1-AP, S100A12 Polyclonal antibody

Size: 20ul / 150ul The S100A12 (16630-1-AP) by Proteintech is a Polyclonal antibody targeting S100A12 in IHC, ELISA applications with reactivity to human samples 16630-1-AP targets S100A12 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information S100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A12 is expressed abundantly in granulocytes, and has been implicated to play an important role on inflammatory reactions in various disease states. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9961 Product name: Recombinant human S100A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC070294 Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE Predict reactive species Full Name: S100 calcium binding protein A12 Calculated Molecular Weight: 92 aa, 11 kDa GenBank Accession Number: BC070294 Gene Symbol: S100A12 Gene ID (NCBI): 6283 RRID: AB_2878290 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P80511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.