Proteintech, 16638-1-AP, TMUB1 Polyclonal antibody

Size: 20ul / 150ul The TMUB1 (16638-1-AP) by Proteintech is a Polyclonal antibody targeting TMUB1 in WB, IF/ICC, ELISA applications with reactivity to human samples 16638-1-AP targets TMUB1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells, L02 cells Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Transmembrane and ubiquitin-like domain-containing protein 1 (TMUB1), also referred to as hepatocyte odd protein shuttling (HOPS), is a transmembrane ubiquitin-like protein that was originally identified in the regenerated liver. HOPS is a transmembrane protein released into the cell by an enzymatic cleavage. This allows HOPS to be shuttled from the nucleus to the cytoplasm and vice versa, depending on cell cycle and environmental stress conditions. HOPS cDNA expression gives rise to the translation of three different proteins with distinct molecular weights of 27, 24 and 21 kDa, respectively.The three isoforms of HOPS are differentially expressed depending on the tissue being examined. In the brain, the shortest isoform prevails over the other, whereas in the intestine the higher molecular weight isoform prevails among the other two. Indeed, HOPS shows a different concentration of the three isoforms, which can play different cell-dependent functions. The ratio between different isoforms may vary owing to physiopathological changes in the cell (PMID:32860479).16638-1-AP can detect two bands and some literature also detected two bands (PMID:30610893, 29777440, 29967478) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9988 Product name: Recombinant human TMUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC000936 Sequence: MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP Predict reactive species Full Name: transmembrane and ubiquitin-like domain containing 1 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 27 kDa, 24 kDa GenBank Accession Number: BC000936 Gene Symbol: TMUB1 Gene ID (NCBI): 83590 RRID: AB_3085503 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.