Iright
BRAND / VENDOR: Proteintech

Proteintech, 16661-1-AP, UGT2B7 Polyclonal antibody

CATALOG NUMBER: 16661-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UGT2B7 (16661-1-AP) by Proteintech is a Polyclonal antibody targeting UGT2B7 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 16661-1-AP targets UGT2B7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat liver tissue, HEK-293 cells Positive IP detected in: rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10121 Product name: Recombinant human UGT2B7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-351 aa of BC030974 Sequence: KVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNT Predict reactive species Full Name: UDP glucuronosyltransferase 2 family, polypeptide B7 Calculated Molecular Weight: 529 aa, 61 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC030974 Gene Symbol: UGT2B7 Gene ID (NCBI): 7364 RRID: AB_2214249 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16662 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924