Proteintech, 16686-1-AP, CKAP4 Polyclonal antibody

Size: 20ul / 150ul The CKAP4 (16686-1-AP) by Proteintech is a Polyclonal antibody targeting CKAP4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16686-1-AP targets CKAP4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, rat kidney tissue, HeLa cells, HepG2 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissue, human liver tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CKAP4, also named as Climp-63, is a 63 kDa cytoskeleton-linking membrane protein. It is the partner of triadin. CKAP4 is responsible for this association of triads and microtubules. It functions as a key structural component, tethering the ER to the microtubule cytoskeleton and thereby regulating ER network morphology and dynamics. Beyond its structural role, CKAP4 has been identified as a multifunctional signaling receptor present on the plasma membrane for various ligands, including tissue plasminogen activator, anti-proliferative factor, and DICKKOPF1 (DKK1). This dual localization enables CKAP4 to participate in diverse cellular processes such as cell proliferation, migration, and immune modulation. Its dysregulation is implicated in several pathological conditions, including cancers, fibrosis, and inflammatory diseases, highlighting its significance as a potential therapeutic target and biomarker. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10019 Product name: Recombinant human CKAP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-602 aa of BC082972 Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV Predict reactive species Full Name: cytoskeleton-associated protein 4 Calculated Molecular Weight: 602 aa, 66 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC082972 Gene Symbol: CKAP4 Gene ID (NCBI): 10970 RRID: AB_2276275 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07065 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.