Proteintech, 16688-1-AP, ATL2 Polyclonal antibody

Size: 20ul / 150ul The ATL2 (16688-1-AP) by Proteintech is a Polyclonal antibody targeting ATL2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 16688-1-AP targets ATL2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, HeLa cells, Jurkat cells, HepG2 cells, SH-SY5Y cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue, mouse kidney tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATL2, also known as Atlastin GTPase 2, is involved in various cellular processes, including the organization of the Golgi apparatus, the endoplasmic reticulum tubular network membrane organization, and protein homooligomerization. It is located in the endoplasmic reticulum tubular network membrane and is an integral component of the membrane. The ATL2 gene has multiple transcripts and isoforms, with 18 transcripts (splice variants), 297 orthologues, and 10 paralogues. ATL2 also plays a significant role in the immune response, particularly in plants. In Arabidopsis thaliana, the ATL2 gene is involved in the response to fungal pathogen infection. The expression of ATL2 is low under normal growth conditions but is rapidly and significantly induced by exogenous chitin.also plays Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10030 Product name: Recombinant human ATL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC053508 Sequence: MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFA Predict reactive species Full Name: atlastin GTPase 2 Calculated Molecular Weight: 412aa,47 kDa; 583aa,66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC053508 Gene Symbol: ATL2 Gene ID (NCBI): 64225 RRID: AB_1850898 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NHH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.