Proteintech, 16706-1-AP, HBQ1 Polyclonal antibody

Size: 20ul / 150ul The HBQ1 (16706-1-AP) by Proteintech is a Polyclonal antibody targeting HBQ1 in WB, IHC, ELISA applications with reactivity to human samples 16706-1-AP targets HBQ1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information HBQ1 (Hemoglobin subunit theta-1) is a member of the human alpha-globin gene cluster. HBQ1 mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue (PMID: 3657976). HBQ1 gene was transcribed in an erythroleukemia cell line. HBQ1 has transcriptionally active and may be expressed in early erythroid tissue (PMID: 3422341). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10105 Product name: Recombinant human HBQ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC056686 Sequence: MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR Predict reactive species Full Name: hemoglobin, theta 1 Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 10~16 kDa GenBank Accession Number: BC056686 Gene Symbol: HBQ1 Gene ID (NCBI): 3049 RRID: AB_1851212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.