Proteintech, 16716-1-AP, GALNT3 Polyclonal antibody

Size: 20ul / 150ul The GALNT3 (16716-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 16716-1-AP targets GALNT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, DU 145 cells, mouse testis tissue, mouse liver tissue, HeLa cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10140 Product name: Recombinant human GALNT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC056246 Sequence: MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPEYVEE Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) Calculated Molecular Weight: 633aa,73 kDa; 192aa,22 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC056246 Gene Symbol: GALNT3 Gene ID (NCBI): 2591 RRID: AB_2878303 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14435 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.