Iright
BRAND / VENDOR: Proteintech

Proteintech, 16720-1-AP, NDUFB11 Polyclonal antibody

CATALOG NUMBER: 16720-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NDUFB11 (16720-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB11 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16720-1-AP targets NDUFB11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NDUFB11(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial) is also named as neuronal protein 17.3(Np17.3) and belongs to the complex I NDUFB11 subunit family. This protein is involved in the transfer of electrons from NADH to the respiratory chain and play a role in the growth, maintenance, and survival of neurons. NDUFB11 has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10159 Product name: Recombinant human NDUFB11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-163 aa of BC107805 Sequence: ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa Calculated Molecular Weight: 163 aa, 18 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC107805 Gene Symbol: NDUFB11 Gene ID (NCBI): 54539 RRID: AB_2298378 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX14 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924