Iright
BRAND / VENDOR: Proteintech

Proteintech, 16723-1-AP, ANTXR2 Polyclonal antibody

CATALOG NUMBER: 16723-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ANTXR2 (16723-1-AP) by Proteintech is a Polyclonal antibody targeting ANTXR2 in WB, IP, IHC, ELISA applications with reactivity to human samples 16723-1-AP targets ANTXR2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-3 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human ovary tissue, human kidney tissue, human placenta tissue, human testis tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ANTXR2 (anthrax toxin receptor 2), also known as CMG2 (capillary morphogenesis gene 2 protein) is a transmembrane protein that is induced during capillary morphogenesis. It contains a vWA domain that shows strong binding to laminin and collagen IV, suggesting that this protein plays a role in basement membrane matrix assembly and endothelial cell morphogenesis (PMID: 11683410; 14508707). Like its paralog TEM8 (ANTXR1), ANTXR2 also functions as a receptor for anthrax toxin. Mutations in ANTXR2 result in the allelic disorders juvenile hyaline fibromatosis and infantile systemic hyalinosis (PMID: 14508707; 12973667; 22383261). Specification Tested Reactivity: human Cited Reactivity: human, camelus bactrianus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10162 Product name: Recombinant human ANTXR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-231 aa of BC107876 Sequence: ISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSL Predict reactive species Full Name: anthrax toxin receptor 2 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC107876 Gene Symbol: ANTXR2 Gene ID (NCBI): 118429 RRID: AB_2056741 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58335 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924