Iright
BRAND / VENDOR: Proteintech

Proteintech, 16726-1-AP, GCSH Polyclonal antibody

CATALOG NUMBER: 16726-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GCSH (16726-1-AP) by Proteintech is a Polyclonal antibody targeting GCSH in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16726-1-AP targets GCSH in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human liver tissue, mouse brain tissue, mouse kidney tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human ovary cancer tissue, human kidney tissue, human liver tissue, human ovary tissue, human skin tissue, rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information GCSH(Glycine cleavage system H protein, mitochondrial) is a component of the glycine cleavage system loosely associated with the mitochondrial inner membrane and has lipoic acid as a prosthetic group. The full-length GCSH cDNA encodes a precursor protein of 173 amino acids and a mature protein of 125 amino acids. The lipoylation of H-protein occurs in mitochondria which probably contain an activated form of lipoic acid as well as other components required for the transfer of lipoic acid to the protein(PMID:2211640). Defects in GCSH are a cause of non-ketotic hyperglycinemia (NKH). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10174 Product name: Recombinant human GCSH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC000790 Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE Predict reactive species Full Name: glycine cleavage system protein H (aminomethyl carrier) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC000790 Gene Symbol: GCSH Gene ID (NCBI): 2653 RRID: AB_2247351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23434 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924