Proteintech, 16750-1-AP, SPOP Polyclonal antibody

Size: 20ul / 150ul The SPOP (16750-1-AP) by Proteintech is a Polyclonal antibody targeting SPOP in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16750-1-AP targets SPOP in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, PC-3 cells Positive IP detected in: HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The SPOP (TEF2) protein was previously identified as an autoantigen in a patient with scleroderma pigmentosum. SPOP (speckle-type POZ protein), also known as TEF2, HIB homolog 1 or Roadkill homolog 1, is a member of the Tdpoz family containing one N-terminal MATH (Meprin and TRAF Homology) domain and one C-terminal BTB/POZ domain. SPOP can exist as a homodimer and is expressed in a variety of tissues localizing to the nucleus. BTB-mediated SPOP dimers form linear oligomers via BACK domain dimerization, and we determine the concentration-dependent populations of the resulting oligomeric species (PMID: 27220849 ). Through an interaction with CUL-3, SPOP is involved in ubiquitinylation and protein degradation. SPOP specifically interacts with CUL-3 via its BTB/POZ domain and recruits substrates to the CUL-3-based ubiquitin ligase via its MATH domain. Substrates recruited by SPOP and targeted for ubiquitylation via the CUL-3/SPOP complex include PDX-1, Bmi-1, MacroH2A, PIPK II ∫ and Daxx. These substrates are subsequently degraded by the proteasome. In addition, SPOP itself becomes ubiquitylated by the CUL-3-based ubiquitin ligase and is targeted for proteasomal degradation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10215 Product name: Recombinant human SPOP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-374 aa of BC003385 Sequence: MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS Predict reactive species Full Name: speckle-type POZ protein Calculated Molecular Weight: 374 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC003385 Gene Symbol: SPOP Gene ID (NCBI): 8405 RRID: AB_2756394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43791 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.