Proteintech, 16752-1-AP, HSD17B8 Polyclonal antibody

Size: 20ul / 150ul The HSD17B8 (16752-1-AP) by Proteintech is a Polyclonal antibody targeting HSD17B8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16752-1-AP targets HSD17B8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, mouse small intestine tissue, human testis tissue Positive IHC detected in: human liver cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10226 Product name: Recombinant human HSD17B8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC008185 Sequence: MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 8 Calculated Molecular Weight: 261 aa, 27 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC008185 Gene Symbol: HSD17B8 Gene ID (NCBI): 7923 RRID: AB_2248540 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92506 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.