Iright
BRAND / VENDOR: Proteintech

Proteintech, 16756-1-AP, GPR97 Polyclonal antibody

CATALOG NUMBER: 16756-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPR97 (16756-1-AP) by Proteintech is a Polyclonal antibody targeting GPR97 in IHC, ELISA applications with reactivity to human, mouse samples 16756-1-AP targets GPR97 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR97, also known as adhesion G-protein-coupled receptor G3 (ADGRG3), belongs to the GPCR family. GPR97 is involved in acute kidney injury (AKI) progression, with GPR97 deficiency reducing renal injury and inflammation in AKI models (PMID: 30559745). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10272 Product name: Recombinant human GPR97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-274 aa of BC064508 Sequence: KPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRYWLNYEAHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLPKSLFRSLPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPEGTVCCCDHLTFFALLLRPTLDQSTVHILTRISQA Predict reactive species Full Name: G protein-coupled receptor 97 Calculated Molecular Weight: 549 aa, 61 kDa GenBank Accession Number: BC064508 Gene Symbol: GPR97 Gene ID (NCBI): 222487 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86Y34 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924