Iright
BRAND / VENDOR: Proteintech

Proteintech, 16757-1-AP, GPT2 Polyclonal antibody

CATALOG NUMBER: 16757-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPT2 (16757-1-AP) by Proteintech is a Polyclonal antibody targeting GPT2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 16757-1-AP targets GPT2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse kidney tissue, HepG2 cells Positive IP detected in: mouse kidney tissue Positive IHC detected in: human skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information GPT2 (Alanine aminotransferase 2; ALT2) is a key enzyme in intermediatary metabolism, catalysing the reversible transfer of the amino group of glutamate to pyruvate, yielding alanine and ketoglutarate. GPT2 protein localizes to mitochondria, and is mainly expressed in the pancreas, brain, adrenal gland, skeletal muscle and heart. Serum GPT2 is a useful marker for liver damage. Recently mutation of GPT2 has been reported to be a cause of neural disorder (27601654). 16757-1-AP antibody recognizes two different isoforms of GPT2 protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10273 Product name: Recombinant human GPT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-523 aa of BC062555 Sequence: VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA Predict reactive species Full Name: glutamic pyruvate transaminase (alanine aminotransferase) 2 Calculated Molecular Weight: 523 aa, 58 kDa Observed Molecular Weight: 58 kDa, 47 kDa GenBank Accession Number: BC062555 Gene Symbol: GPT2 Gene ID (NCBI): 84706 RRID: AB_2112098 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TD30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924