Proteintech, 16762-1-AP, AGPAT6 Polyclonal antibody

Size: 20ul / 150ul The AGPAT6 (16762-1-AP) by Proteintech is a Polyclonal antibody targeting AGPAT6 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16762-1-AP targets AGPAT6 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse testis tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human testis tissue, human kidney tissue, human liver tissue, human ovary tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information AGPAT6 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase (AGPAT) family. AGPAT6 is expressed in brown adipose tissue and mammary epithelium as well as many other tissues. A deficiency of AGPAT6 in mice results in resistance to dietinduced and genetic forms of obesity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10294 Product name: Recombinant human AGPAT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 206-456 aa of BC051377 Sequence: KEFMSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS Predict reactive species Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) Calculated Molecular Weight: 456 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC051377 Gene Symbol: AGPAT6 Gene ID (NCBI): 137964 RRID: AB_1850878 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.