Proteintech, 16763-1-AP, CD6 Polyclonal antibody

Size: 20ul / 150ul The CD6 (16763-1-AP) by Proteintech is a Polyclonal antibody targeting CD6 in IHC, ELISA applications with reactivity to human samples 16763-1-AP targets CD6 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CD6 is a type I transmembrane glycoprotein of 105-130 kDa that belongs to the scavenger receptor cysteine-rich superfamily (PMID: 21880988). It is composed of an extracellular region, which consists of three tandem SRCR domains, a transmembrane region, and a cytoplasmic tail devoid of intrinsic catalytic activity but harboring several phosphorylatable residues suitable for intracellular signal transduction (PMID: 38139340; 23711376). CD6 is expressed by T cells, medullary thymocytes, a subset of B cells and NK cells, and in some cells of the brain (PMID: 1919444; 21178331). CD6 plays a role in lymphocyte activation, proliferation, and survival processes via interaction with its endogenous ligands. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10336 Product name: Recombinant human CD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-350 aa of BC078669 Sequence: SGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFMPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLC Predict reactive species Full Name: CD6 molecule Calculated Molecular Weight: 668 aa, 72 kDa GenBank Accession Number: BC078669 Gene Symbol: CD6 Gene ID (NCBI): 923 RRID: AB_2878312 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30203 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.