Iright
BRAND / VENDOR: Proteintech

Proteintech, 16775-1-AP, Apolipoprotein C1/APOC1 Polyclonal antibody

CATALOG NUMBER: 16775-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Apolipoprotein C1/APOC1 (16775-1-AP) by Proteintech is a Polyclonal antibody targeting Apolipoprotein C1/APOC1 in IHC, ELISA applications with reactivity to human samples 16775-1-AP targets Apolipoprotein C1/APOC1 in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10119 Product name: Recombinant human APOC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC055093 Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS Predict reactive species Full Name: apolipoprotein C-I Calculated Molecular Weight: 83 aa, 9 kDa GenBank Accession Number: BC055093 Gene Symbol: APOC1 Gene ID (NCBI): 341 RRID: AB_2878314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02654 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924