Iright
BRAND / VENDOR: Proteintech

Proteintech, 16781-1-AP, DcR2 Polyclonal antibody

CATALOG NUMBER: 16781-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DcR2 (16781-1-AP) by Proteintech is a Polyclonal antibody targeting DcR2 in WB, IHC, ELISA applications with reactivity to human samples 16781-1-AP targets DcR2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, DU 145 cells, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Decoy receptor 2 (DcR2) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It functions as a decoy receptor for TNF-related apoptosis-inducing ligand (TRAIL), thereby inhibiting TRAIL-mediated apoptosis (PMID: 15538968; 9537512). It has been considered a tentative marker of cellular senescence (PMID: 16079833; 22751116). Additionally, DCR2 has been implicated in the regulation of renal fibrosis and cell senescence, contributing to the pathogenesis of diabetic nephropathy (PMID: 35661704). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10208 Product name: Recombinant human TRAILR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-386 aa of BC052270 Sequence: FSCRKKFISYLKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVESPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain Calculated Molecular Weight: 386 aa, 42 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC052270 Gene Symbol: DcR2 Gene ID (NCBI): 8793 RRID: AB_2256181 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924