Proteintech, 16783-1-AP, LACTB2 Polyclonal antibody

Size: 20ul / 150ul The LACTB2 (16783-1-AP) by Proteintech is a Polyclonal antibody targeting LACTB2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16783-1-AP targets LACTB2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, PC-3 cells, Y79 cells, A549 cells, HeLa cells Positive IP detected in: A549 cells Positive IHC detected in: human cervix tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10213 Product name: Recombinant human LACTB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-288 aa of BC000878 Sequence: MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL Predict reactive species Full Name: lactamase, beta 2 Calculated Molecular Weight: 288 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000878 Gene Symbol: LACTB2 Gene ID (NCBI): 51110 RRID: AB_2133333 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53H82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.