Proteintech, 16797-1-AP, LITAF Polyclonal antibody

Size: 20ul / 150ul The LITAF (16797-1-AP) by Proteintech is a Polyclonal antibody targeting LITAF in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 16797-1-AP targets LITAF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Lipopolysaccharide-induced TNF factor(LITAF) is a transcription factor that identified as a regulator of TNF-alpha gene expression. It may has a role in protein degradation pathways and in tumor necrosis factor alpha(TNF-alpha) gene expression. Also it may regulate the expression of the CCL2/MCP-1 chemokine through NFKB1.Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10269 Product name: Recombinant human LITAF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC008309 Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSC Predict reactive species Full Name: lipopolysaccharide-induced TNF factor Calculated Molecular Weight: 161 aa, 17 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC008309 Gene Symbol: LITAF Gene ID (NCBI): 9516 RRID: AB_2135710 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99732 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.