Product Description
Size: 20ul / 150ul
The MRPL52 (16800-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL52 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
16800-1-AP targets MRPL52 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: human kidney tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag10280 Product name: Recombinant human MRPL52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC068070 Sequence: MAALGTVLFTGVRRLHCSAAAWAGGQWRLQQGLAANPSGYGPLTELPDCSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ Predict reactive species
Full Name: mitochondrial ribosomal protein L52
Calculated Molecular Weight: 123 aa, 14 kDa
Observed Molecular Weight: 18-21 kDa
GenBank Accession Number: BC068070
Gene Symbol: MRPL52
Gene ID (NCBI): 122704
RRID: AB_2250853
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q86TS9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924