Proteintech, 16812-1-AP, LMF1 Polyclonal antibody

Size: 20ul / 150ul The LMF1 (16812-1-AP) by Proteintech is a Polyclonal antibody targeting LMF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16812-1-AP targets LMF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information LMF1, also named as C16orf26 and TMEM112, is involved in the maturation of lipoprotein lipase (LPL) and hepatic lipase in endoplasmic reticulum. It is required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10349 Product name: Recombinant human LMF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-486 aa of BC010738 Sequence: VRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVILQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWIIHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRIGAYFPPLSLEELRPYFRDRGWPL Predict reactive species Full Name: lipase maturation factor 1 Calculated Molecular Weight: 567 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC010738 Gene Symbol: LMF1 Gene ID (NCBI): 64788 RRID: AB_2878320 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.