Proteintech, 16820-1-AP, ZC3HAV1 Polyclonal antibody

Size: 20ul / 150ul The ZC3HAV1 (16820-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3HAV1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 16820-1-AP targets ZC3HAV1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The zinc-finger antiviral protein (ZAP) was originally identifed from a rat cDNA library due to its conferring resistance to retroviruses. ZC3HAV1 is a CCCH-type zinc finger protein, it may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms. ZC3HAV1 exists some isoforms with MV 101, 77, 67, 42 and 18 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10364 Product name: Recombinant human ZC3HAV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC025308 Sequence: MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLAS Predict reactive species Full Name: zinc finger CCCH-type, antiviral 1 Calculated Molecular Weight: 699aa,78 kDa; 902aa,101 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC025308 Gene Symbol: ZC3HAV1 Gene ID (NCBI): 56829 RRID: AB_2728733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z2W4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.