Proteintech, 16821-1-AP, SRF Polyclonal antibody

Size: 20ul / 150ul The SRF (16821-1-AP) by Proteintech is a Polyclonal antibody targeting SRF in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 16821-1-AP targets SRF in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, MCF-7 cells, K-562 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF is required for cardiac differentiation and maturation due to the role in cardiac cell growth and muscle gene regulation. The full-length SRF protein is 67 kDa and molecular weight of cleaved fragment is 50 kDa and 20 kDa (PMID: 21769134). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10386 Product name: Recombinant human SRF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-348 aa of BC048211 Sequence: MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPG Predict reactive species Full Name: serum response factor (c-fos serum response element-binding transcription factor) Calculated Molecular Weight: 508 aa, 52 kDa Observed Molecular Weight: 65-70 kDa, 40 kDa GenBank Accession Number: BC048211 Gene Symbol: SRF Gene ID (NCBI): 6722 RRID: AB_2194384 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.