Proteintech, 16830-1-AP, NIP30 Polyclonal antibody

Size: 20ul / 150ul The NIP30 (16830-1-AP) by Proteintech is a Polyclonal antibody targeting NIP30 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16830-1-AP targets NIP30 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NIP30, also known as NEFA-interacting nuclear protein 30, FAM192A (family with sequence similarity 192, member A), is a 254 amino acid nuclear protein encoded by a gene that maps to human chromosome 16q13. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10439 Product name: Recombinant human NIP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC071952 Sequence: MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP Predict reactive species Full Name: NEFA-interacting nuclear protein NIP30 Calculated Molecular Weight: 254 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC071952 Gene Symbol: NIP30 Gene ID (NCBI): 80011 RRID: AB_2109703 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.