Iright
BRAND / VENDOR: Proteintech

Proteintech, 16841-1-AP, SETBP1 Polyclonal antibody

CATALOG NUMBER: 16841-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SETBP1 (16841-1-AP) by Proteintech is a Polyclonal antibody targeting SETBP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16841-1-AP targets SETBP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information SETBP1 is initially found to interact with SET, which is a small protein inhibitor for tumor suppressors PP2A and NM23-H1. There are existing two isoforms of SETBP1 and the molecular weight of isoform one is 170 kDa and another is 26 kDa. SET is fused with another gene CAN through chromosome translocation in a case of acute undifferentiated leukemia. SETBP1 may involve in chromosome translocation in a case of acute T-cell leukemia [PMID:17569777]. SETBP1 can cooperate with BCR/ABL to transform committed myeloid progenitors normally lacking self-renewal capability into LSCs and cause development of myeloid leukemias resembling human CML myeloid blast crisis [PMID:22566606]. SETBP1 was shown to form a complex with SET and PP2A, enhancing the stability of SET and its inhibition of PP2A. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10532 Product name: Recombinant human SETBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC062338 Sequence: MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERAMCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEV Predict reactive species Full Name: SET binding protein 1 Calculated Molecular Weight: 175 kDa, 26 kDa Observed Molecular Weight: 170-180 kDa GenBank Accession Number: BC062338 Gene Symbol: SETBP1 Gene ID (NCBI): 26040 RRID: AB_2185750 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6X0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924