Iright
BRAND / VENDOR: Proteintech

Proteintech, 16842-1-AP, HEBP1 Polyclonal antibody

CATALOG NUMBER: 16842-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HEBP1 (16842-1-AP) by Proteintech is a Polyclonal antibody targeting HEBP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16842-1-AP targets HEBP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, A549 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information HEBP1 (heme binding protein 1) is an intracellular tetrapyrrole-binding protein. Catalog#16842-1-AP is a rabbit polyclonal antibody raised against the full-length of human HEBP1. The MW of this protein is 21 kDa, and this antibody specially recognises the 21 kDa protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10538 Product name: Recombinant human HEBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC016277 Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT Predict reactive species Full Name: heme binding protein 1 Calculated Molecular Weight: 189 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC016277 Gene Symbol: HEBP1 Gene ID (NCBI): 50865 RRID: AB_2117378 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924