Iright
BRAND / VENDOR: Proteintech

Proteintech, 16887-1-AP, TSR1 Polyclonal antibody

CATALOG NUMBER: 16887-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TSR1 (16887-1-AP) by Proteintech is a Polyclonal antibody targeting TSR1 in WB, ELISA applications with reactivity to human, mouse samples 16887-1-AP targets TSR1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10394 Product name: Recombinant human TSR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 411-759 aa of BC019090 Sequence: DDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFSQHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWTYDPYVPEPVPWLKSEISSTVPQGGME Predict reactive species Full Name: TSR1, 20S rRNA accumulation, homolog (S. cerevisiae) Calculated Molecular Weight: 804 aa, 92 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC019090 Gene Symbol: TSR1 Gene ID (NCBI): 55720 RRID: AB_2222589 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2NL82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924