Iright
BRAND / VENDOR: Proteintech

Proteintech, 16896-1-AP, VPS33A Polyclonal antibody

CATALOG NUMBER: 16896-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VPS33A (16896-1-AP) by Proteintech is a Polyclonal antibody targeting VPS33A in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 16896-1-AP targets VPS33A in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, HepG2 cells, human cerebellum tissue, NIH/3T3 cells Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information VPS33A is a Sec1/Munc18 family member and is a component of the homotypic fusion and protein sorting (HOPS)-tethering complex. The mammalian HOPS complex comprises six subunits (VPS11, VPS16, VPS18, VPS33A, VPS39, and VPS41) (PMID: 23901104). This complex is required for late endosome-lysosome and autophagosome-lysosome fusion (PMID: 24554770). VPS33A plays a role in vesicular transport to the lysosomal compartment. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10422 Product name: Recombinant human VPS33A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-596 aa of BC016617 Sequence: YEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF Predict reactive species Full Name: vacuolar protein sorting 33 homolog A (S. cerevisiae) Calculated Molecular Weight: 596 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC016617 Gene Symbol: VPS33A Gene ID (NCBI): 65082 RRID: AB_2214916 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AX1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924