Proteintech, 16914-1-AP, FAM156A Polyclonal antibody

Size: 20ul / 150ul The FAM156A (16914-1-AP) by Proteintech is a Polyclonal antibody targeting FAM156A in WB, IHC, ELISA applications with reactivity to human, mouse samples 16914-1-AP targets FAM156A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-13 cells Positive IHC detected in: human lung cancer tissue, human heart tissue, human liver tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10001 Product name: Recombinant human FAM156A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-174 aa of BC000867 Sequence: MMGLSNLSPGPGPSQAVPLPEGLLRQRYREEKTLEERRWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRSQNRFRCECRYCQSHRPNLSGIPGESNRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQQESKIMFQRLLKQWLEEN Predict reactive species Full Name: family with sequence similarity 156, member A Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC000867 Gene Symbol: FAM156A Gene ID (NCBI): 29057 RRID: AB_2101209 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NDB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.