Proteintech, 16943-1-AP, IWS1 Polyclonal antibody

Size: 20ul / 150ul The IWS1 (16943-1-AP) by Proteintech is a Polyclonal antibody targeting IWS1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16943-1-AP targets IWS1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human brain tissue, mouse brain tissue, rat brain tissue, HeLa cells, Jurkat cells Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IWS1, as a transcription elongation factor, functions to recruit cofactors to the RNA polymerase II (RNAPII) complex to regulate mRNA alternative splicing (PMID: 30846735; 37237004). It plays a key role in defining the composition of the RNA polymerase II (RNAPII) elongation complex and in modulating the production of mature mRNA transcripts. It also acts as an assembly factor to recruit various factors to the RNAPII elongation complex and is recruited to the complex via binding to the transcription elongation factor SUPT6H bound to the C-terminal domain (CTD) of the RNAPII subunit RPB1 (POLR2A). The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10) as well as histone modifying enzymes (such as SETD2) to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription (PMID: 17184735; 17234882; 19141475). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10554 Product name: Recombinant human IWS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-298 aa of BC017012 Sequence: HMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQATSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL Predict reactive species Full Name: IWS1 homolog (S. cerevisiae) Calculated Molecular Weight: 819 aa, 92 kDa Observed Molecular Weight: 116-120 kDa GenBank Accession Number: BC017012 Gene Symbol: IWS1 Gene ID (NCBI): 55677 RRID: AB_2128229 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96ST2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.