Iright
BRAND / VENDOR: Proteintech

Proteintech, 16949-1-AP, CPLX3 Polyclonal antibody

CATALOG NUMBER: 16949-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CPLX3 (16949-1-AP) by Proteintech is a Polyclonal antibody targeting CPLX3 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 16949-1-AP targets CPLX3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue Positive IP detected in: mouse brain tissue Positive IF-P detected in: rat eye tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CPLX3, also named as Complexin-3, is 158 amino acid protein, which belongs to the complexin/synaphin family. CPLX3 localizes in the membrane and binds to the SNARE core complex containing SNAP25, VAMP2 and STX1A. CPLX3 positively regulates a late step in synaptic vesicle exocytosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10571 Product name: Recombinant human CPLX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC018026 Sequence: MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM Predict reactive species Full Name: complexin 3 Calculated Molecular Weight: 158 aa, 18 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC018026 Gene Symbol: CPLX3 Gene ID (NCBI): 594855 RRID: AB_2084042 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVH0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924