Iright
BRAND / VENDOR: Proteintech

Proteintech, 16957-1-AP, MTERF Polyclonal antibody

CATALOG NUMBER: 16957-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MTERF (16957-1-AP) by Proteintech is a Polyclonal antibody targeting MTERF in WB, ELISA applications with reactivity to human, mouse, rat samples 16957-1-AP targets MTERF in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Mitochondrial transcription termination factor (MTERF)also named as Mterf1 is a 399 amino acid protein, which localizes in the mitochondrion and belongs to the mTERF family. MTERF contains three leucine zippers that form a three-stranded coiled-coil that binds to DNA. It has been suggested that only the phosphorylated form of MTERF has transcription termination activity. MTERF plays a central role in the control of mitochondrial rRNA and mRNA synthesis. MTERFD1 is also thought to act as a mitochondrial transcription regulator and is expressed as two isoforms produced by alternative splicing.Using DNA affinity chromatography, a fraction called MTERF was found to be associated with foot-printing capacity, and this contained two polypeptides of 34 and 31 kDa. Moreover, termination-promoting activity appears to reside in the 34-kDa protein. (PMID:7681833). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10640 Product name: Recombinant human MTERF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-399 aa of BC000965 Sequence: MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPTDFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA Predict reactive species Full Name: mitochondrial transcription termination factor Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC000965 Gene Symbol: MTERF Gene ID (NCBI): 7978 RRID: AB_2235580 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99551 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924