Proteintech, 16963-1-AP, MYL6B Polyclonal antibody

Size: 20ul / 150ul The MYL6B (16963-1-AP) by Proteintech is a Polyclonal antibody targeting MYL6B in WB, IHC, ELISA applications with reactivity to human, mouse samples 16963-1-AP targets MYL6B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HuH-7 cells, mouse testis tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MYL6B, also known as MLC1SA, is primarily found in a hexamer consisting of four light chains and two heavy chains. MYL6B is an essential light chain for non-muscle Myosin II (NMII) that is involved in the control of cell adhesion, cell migration and tissue architecture, cargo transport, and endocytosis (PMID: 29439719, 33817240). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10683 Product name: Recombinant human MYL6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC012425 Sequence: MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV Predict reactive species Full Name: myosin, light chain 6B, alkali, smooth muscle and non-muscle Calculated Molecular Weight: 208 aa, 23 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC012425 Gene Symbol: MYL6B Gene ID (NCBI): 140465 RRID: AB_3085512 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14649 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.