Proteintech, 16984-1-AP, PHYHIP Polyclonal antibody

Size: 20ul / 150ul The PHYHIP (16984-1-AP) by Proteintech is a Polyclonal antibody targeting PHYHIP in WB, ELISA applications with reactivity to human, mouse, rat samples 16984-1-AP targets PHYHIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PHYHIP, also named as DYRK1AP3 and KIAA0273, belongs to the PHYHIP family. Its interaction with PHYH suggests a role in the development of the central system. This antibody recognizes both PHYHIP (35-38 kDa) and PHYHIPL (43-45 kDa). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10575 Product name: Recombinant human PHYHIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-330 aa of BC034034 Sequence: MELLSTPHSIEINNITCDSFSISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFEHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSMGDRFCRDRRPLLDIACNKFLTCSVEDGELVFRHAQDLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR Predict reactive species Full Name: phytanoyl-CoA 2-hydroxylase interacting protein Calculated Molecular Weight: 330 aa, 38 kDa Observed Molecular Weight: 35 kDa, 43-45 kDa GenBank Accession Number: BC034034 Gene Symbol: PHYHIP Gene ID (NCBI): 9796 RRID: AB_2163759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92561 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.