Proteintech, 17030-1-AP, H2AFY2 Polyclonal antibody

Size: 20ul / 150ul The H2AFY2 (17030-1-AP) by Proteintech is a Polyclonal antibody targeting H2AFY2 in WB, IP, ELISA applications with reactivity to human, mouse samples 17030-1-AP targets H2AFY2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, human liver tissue, mouse kidney tissue Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10487 Product name: Recombinant human Histone H2A.2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-372 aa of BC016172 Sequence: MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK Predict reactive species Full Name: H2A histone family, member Y2 Calculated Molecular Weight: 372 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC016172 Gene Symbol: H2AFY2 Gene ID (NCBI): 55506 RRID: AB_10638483 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0M6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.