Proteintech, 17036-1-AP, RWDD1 Polyclonal antibody

Size: 20ul / 150ul The RWDD1 (17036-1-AP) by Proteintech is a Polyclonal antibody targeting RWDD1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 17036-1-AP targets RWDD1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse thymus tissue, HeLa cells, Jurkat cells, rat thymus tissue Positive IP detected in: mouse thymus tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RWDD1(RWD domain-containing protein 1) is also named as DFRP2(DRG family-regulatory protein 2) and belongs to the RWDD1/GIR2 family. RWDD1 is a thymus aging-related protein which contains an RWD domain at its N-terminus and it is expressed in both thymocytes and thymic epithelial cells and located primarily in the cytoplasm. This protein expression in thymus is decreased in aged and oxidatively stressed mice (PMID:18954556). RWDD1 has a calculated molecular mass of 28 kDa, and apparent molecular mass of 32-36 kDa due to its high acidic amino acid composition that results in the slowed migration behavior in electrophoresis (PMID: 30278355, 18954556). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10525 Product name: Recombinant human RWDD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC015802 Sequence: MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESDSAD Predict reactive species Full Name: RWD domain containing 1 Calculated Molecular Weight: 243 aa, 28 kDa Observed Molecular Weight: 28-36 kDa GenBank Accession Number: BC015802 Gene Symbol: RWDD1 Gene ID (NCBI): 51389 RRID: AB_2184704 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H446 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.