Proteintech, 17049-1-AP, LATS1 Polyclonal antibody

Size: 20ul / 150ul The LATS1 (17049-1-AP) by Proteintech is a Polyclonal antibody targeting LATS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 17049-1-AP targets LATS1 in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, SH-SY5Y cells, HT-29 cells, A549 cells, C2C12 cells Positive IHC detected in: human breast cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10709 Product name: Recombinant human LATS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species Full Name: LATS, large tumor suppressor, homolog 1 (Drosophila) Calculated Molecular Weight: 15 kDa, 127 kDa Observed Molecular Weight: 140-150 kDa, 120 kDa GenBank Accession Number: BC015665 Gene Symbol: LATS1 Gene ID (NCBI): 9113 RRID: AB_2281011 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PJG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.