Proteintech, 17063-1-AP, ZNF22 Polyclonal antibody

Size: 20ul / 150ul The ZNF22 (17063-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF22 in WB, ELISA applications with reactivity to human, mouse, rat samples 17063-1-AP targets ZNF22 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ZNF22, also named as Zinc finger protein 22, is a 224 amino acid protein, which contains 5 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. In the embryo, ZNF22 is expressed in developing craniofacial structures including dental epithelium of maxillary molar tooth organs, tongue epithelium and muscle, and craniofacial bone osteoblasts. In the adult, ZNF22 is expressed in mesoderm-derived tissues such as skeletal muscle, heart, kidney and liver. Intermediate expression in spleen, thymus and brain. ZNF22 binds DNA through the consensus sequence 5'-CAATG-3' and may be involved in transcriptional regulation and may play a role in tooth formation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10833 Product name: Recombinant human ZNF22 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-224 aa of BC010642 Sequence: MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR Predict reactive species Full Name: zinc finger protein 22 (KOX 15) Calculated Molecular Weight: 224 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC010642 Gene Symbol: ZNF22 Gene ID (NCBI): 7570 RRID: AB_2878343 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17026 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.