Proteintech, 17067-1-AP, LARP7 Polyclonal antibody

Size: 20ul / 150ul The LARP7 (17067-1-AP) by Proteintech is a Polyclonal antibody targeting LARP7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17067-1-AP targets LARP7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, human brain tissue, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, human placenta tissue, human testis tissue, human skin tissue, human liver tissue, human spleen tissue, human stomach cancer tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation. binds to and stabilizes 7sk snRNA[PMID:19416841]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10891 Product name: Recombinant human LARP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-331 aa of BC006981 Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE Predict reactive species Full Name: La ribonucleoprotein domain family, member 7 Calculated Molecular Weight: 582 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC006981 Gene Symbol: LARP7 Gene ID (NCBI): 51574 RRID: AB_2132693 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4G0J3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.