Proteintech, 17090-1-AP, MFF Polyclonal antibody

Size: 20ul / 150ul The MFF (17090-1-AP) by Proteintech is a Polyclonal antibody targeting MFF in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17090-1-AP targets MFF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse heart tissue, rat heart tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human stomach tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MFF (mitochondrial fission factor) is a mitochondrial outer membrane protein that is involved in mitochondrial localization of Drp1 and mitochondrial fission. Multiple isoforms of MFF exist due to the alternative splicing. This antibody recognizes the endogenous MFF protein around 26-29 kDa and 35-38 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey, hamster, goat, squirrel Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9990 Product name: Recombinant human MFF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC000797 Sequence: MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR Predict reactive species Full Name: mitochondrial fission factor Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC000797 Gene Symbol: MFF Gene ID (NCBI): 56947 RRID: AB_2142463 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.