Iright
BRAND / VENDOR: Proteintech

Proteintech, 17093-1-AP, TM9SF3 Polyclonal antibody

CATALOG NUMBER: 17093-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TM9SF3 (17093-1-AP) by Proteintech is a Polyclonal antibody targeting TM9SF3 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 17093-1-AP targets TM9SF3 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse stomach tissue Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information TM9SF3, also known as SMBP, EP70-P-iso, encodes transmembrane 9 superfamily member 3, one of the members of the TM9SF family also known as nonaspanins. TM9SF members are characterized by a large noncytoplasmic domain and nine putative transmembrane domains (PMID: 24642718). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10550 Product name: Recombinant human TM9SF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-155 aa of BC020959 Sequence: SISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWGIVGEADENGEDYYLWTYKKLEIGFNGNRIVDVNLTSEGKVKLVPNTKIQMSYSVKWKKSDVKFEDRFDKYLDPSFFQHRIHW Predict reactive species Full Name: transmembrane 9 superfamily member 3 Calculated Molecular Weight: 589 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC020959 Gene Symbol: TM9SF3 Gene ID (NCBI): 56889 RRID: AB_3669259 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HD45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924